Gene
| Gene Model ID | pfu_aug2.0_9364.1_16377 |
|---|---|
| Locus | scaffold9364.1 : 6288 ... 7638 : - |
| To GenomeBrowser | scaffold9364.1:6288..7638 |
| Genes list of scaffold | scaffold9364.1 |
| Synonym | pfu_aug1.0_5528.1_09130 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| methylmalonyl- mitochondrial | GO:0004493 GO:0005739 GO:0046491 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_9364.1_16377.t1 | gi|676439768|ref|XP_009048959.1| | hypothetical protein LOTGIDRAFT_140877, partial [Lottia gigantea] | 3.0e-21 |
| pfu_aug2.0_9364.1_16377.t1 | gi|744580318|ref|XP_010983648.1| | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Camelus dromedarius] | 7.0e-20 |
| pfu_aug2.0_9364.1_16377.t1 | gi|743747519|ref|XP_010968479.1| | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Camelus bactrianus] | 9.0e-20 |
| pfu_aug2.0_9364.1_16377.t1 | gi|395502555|ref|XP_003755644.1| | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Sarcophilus harrisii] | 1.0e-19 |
| pfu_aug2.0_9364.1_16377.t1 | gi|731246907|ref|XP_010636515.1| | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Fukomys damarensis] | 1.0e-19 |
Transcript
| Transcript ID | pfu_aug2.0_9364.1_16377.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_9364.1_16377.t1 gtagacgatatcgaggaggctatgaaagatctgaagtcaaagaatatcagactattaagtgacactgctagaatcggtgc ccatggaaaacctgtagtgttccttcatccgaaagactgtaatggtgtactggtggaactggaacaagcttga |
|
Protein
| Protein ID | pfu_aug2.0_9364.1_16377.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_9364.1_16377.t1 VDDIEEAMKDLKSKNIRLLSDTARIGAHGKPVVFLHPKDCNGVLVELEQA |
|