Gene
| Gene Model ID | pfu_aug2.0_60.1_00145 |
|---|---|
| Locus | scaffold60.1 : 13206 ... 25369 : + |
| To GenomeBrowser | scaffold60.1:13206..25369 |
| Genes list of scaffold | scaffold60.1 |
| Synonym | pfu_aug1.0_331.1_07481 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| golgi snap receptor complex member 2-like | GO:0000139 GO:0005795 GO:0015031 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_60.1_00145.t1 | 1 | 1 | V-SNARE_C | 7 | 66 | 3.8e-18 | 65.3 | 6.3e-22 | 4.7e-18 | 65.0 |
| pfu_aug2.0_60.1_00145.t1 | 1 | 1 | Sec20 | 10 | 89 | 8.4e-06 | 25.4 | 1.4e-09 | 1.1e-05 | 25.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_60.1_00145.t1 | gi|676493015|ref|XP_009066109.1| | hypothetical protein LOTGIDRAFT_222883 [Lottia gigantea] | 5.0e-38 |
| pfu_aug2.0_60.1_00145.t1 | gi|198435199|ref|XP_002130373.1| | PREDICTED: Golgi SNAP receptor complex member 2 [Ciona intestinalis] | 9.0e-35 |
| pfu_aug2.0_60.1_00145.t1 | gi|260806105|ref|XP_002597925.1| | hypothetical protein BRAFLDRAFT_58821 [Branchiostoma floridae] | 5.0e-34 |
| pfu_aug2.0_60.1_00145.t1 | gi|390350382|ref|XP_794856.3| | PREDICTED: Golgi SNAP receptor complex member 2-like [Strongylocentrotus purpuratus] | 1.0e-32 |
| pfu_aug2.0_60.1_00145.t1 | gi|704489296|ref|XP_010075150.1| | PREDICTED: Golgi SNAP receptor complex member 2-like, partial [Pterocles gutturalis] | 3.0e-32 |
Transcript
| Transcript ID | pfu_aug2.0_60.1_00145.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_60.1_00145.t1 atggatgctggactggcccatcattccagacttcacgattcacacagagaaatcgataacataatagatacaggttctaa cgtatttgataacttacgacagcagcggatgaccttgaagggagctcataaaaaggtgttagatttggcaaatacactcg gactctcaaatactgtcatgagaatgattgaaaaacgtacatatcaggataaatacattttatttggtggtatgatagtt acaggcgtcataatgttccttatatggaaatattttacttga |
|
Protein
| Protein ID | pfu_aug2.0_60.1_00145.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_60.1_00145.t1 MDAGLAHHSRLHDSHREIDNIIDTGSNVFDNLRQQRMTLKGAHKKVLDLANTLGLSNTVMRMIEKRTYQDKYILFGGMIV TGVIMFLIWKYFT |
|