Gene
| Gene Model ID | pfu_aug2.0_1120.1_01396 |
|---|---|
| Locus | scaffold1120.1 : 98083 ... 101975 : - |
| To GenomeBrowser | scaffold1120.1:98083..101975 |
| Genes list of scaffold | scaffold1120.1 |
| Synonym | pfu_aug1.0_532.1_65500 |
Manual annotation
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| 26s protease regulatory subunit 10b | GO:0000502 GO:0005524 GO:0005737 GO:0006508 GO:0008233 GO:0030163 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| pfu_aug2.0_1120.1_01396.t1 | 2 | 1 | AAA | 1 | 40 | 3.6e-08 | 33.6 | 4.7e-12 | 6.9e-08 | 32.7 |
| pfu_aug2.0_1120.1_01396.t1 | 2 | 2 | AAA | 92 | 109 | 3.6e-08 | 33.6 | 0.43 | 6400.0 | -2.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| pfu_aug2.0_1120.1_01396.t1 | gi|524895342|ref|XP_005104156.1| | PREDICTED: 26S protease regulatory subunit 10B-like [Aplysia californica] | 0.0 |
| pfu_aug2.0_1120.1_01396.t1 | gi|676489108|ref|XP_009064830.1| | hypothetical protein LOTGIDRAFT_132169 [Lottia gigantea] | 0.0 |
| pfu_aug2.0_1120.1_01396.t1 | gi|91094943|ref|XP_967788.1| | PREDICTED: 26S protease regulatory subunit 10B [Tribolium castaneum] | 0.0 |
| pfu_aug2.0_1120.1_01396.t1 | gi|675848152|ref|XP_009009636.1| | hypothetical protein HELRODRAFT_155612 [Helobdella robusta] | 0.0 |
| pfu_aug2.0_1120.1_01396.t1 | gi|347965832|ref|XP_321726.5| | AGAP001407-PA [Anopheles gambiae str. PEST] | 0.0 |
Transcript
| Transcript ID | pfu_aug2.0_1120.1_01396.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1120.1_01396.t1 atggatgggtttgatgctttaggacaagttaagatgataatggccacgaacagaccagatacattagacccagctttact tagacctggaagactcgatagaaaaatagagattcctcttccaaatgaacagtctaggctagaaatcctaaagattcacg cacaaccaatagcaaaacatggagaaattgactgggaagcagttgtaaagctgtctgatgatttcaatggtgcagatctg agaaatgtgtgtacagaagcaggtatgtttgccataagagcagagagagattatgtgattgaggaggactttatgaaagc agtaaggaaagttgctgataacaagaaactggaatcaaagcttgactacaaacctatctaa |
|
Protein
| Protein ID | pfu_aug2.0_1120.1_01396.t1 |
|---|---|
| Definition | - |
>pfu_aug2.0_1120.1_01396.t1 MDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQSRLEILKIHAQPIAKHGEIDWEAVVKLSDDFNGADL RNVCTEAGMFAIRAERDYVIEEDFMKAVRKVADNKKLESKLDYKPI |
|