Gene
Gene Model ID | pfu_aug1.0_15458.1_46880 |
---|---|
Locus | scaffold15458.1 : 33476 ... 38486 : + |
To GenomeBrowser | scaffold15458.1:33476..38486 |
Genes list of scaffold | scaffold15458.1 |
Synonym | pfu_aug2.0_90.1_00203 |
Manual annotation
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_15458.1_46880.t1 | 1 | 1 | Ribosomal_S7e | 7 | 49 | 2.5e-11 | 43.4 | 1.8e-15 | 2.7e-11 | 43.3 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_15458.1_46880.t1 | gi|22758886|gb|AAN05602.1| | ribosomal protein S7 [Argopecten irradians] | 4.0e-18 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)Libraries | EST count |
---|---|
>Embryonic/Larval stages | |
mix | 2 |
egg-4cell | 1 |
8-16cell | 1 |
egg-Dshape | 1 |
trochophore | 1 |
>Adult tissues | |
Dshape | 1 |
maleGonad | 1 |
mantle | 1 |
mantleEdge | 1 |
mantlePallium | 1 |
pearlSac | 1 |
Transcript
Transcript ID | pfu_aug1.0_15458.1_46880.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15458.1_46880.t1 atgtattcggcgagcgctaaaattgttaagccccaaggggaaaagccagatgagtttgaatcttcaatctcacaggcatt gctggagttggaaatgaatagtgatctaaaagctcagctcagagaactgtatatcactggtgccaag |
Protein
Protein ID | pfu_aug1.0_15458.1_46880.t1 |
---|---|
Definition | - |
>pfu_aug1.0_15458.1_46880.t1 MYSASAKIVKPQGEKPDEFESSISQALLELEMNSDLKAQLRELYITGAK |